PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030452
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 376aa    MW: 41454 Da    PI: 8.4136
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030452genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.84e-1673118147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v ++G+ +W++Ia+++  gR++k+c++rw++ 
      Lus10030452  73 RGHWRPAEDSKLKELVSLYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 118
                      899*****************************.***********996 PP

2Myb_DNA-binding537.7e-17125168146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r +++++E+e+l +a++ +G++ W+ Iar ++ gRt++ +k++w+ 
      Lus10030452 125 RRAFSEDEEERLMQAHRVYGNK-WAMIARLFP-GRTDNAVKNHWHV 168
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.99668119IPR017930Myb domain
SMARTSM007174.7E-1472121IPR001005SANT/Myb domain
SuperFamilySSF466891.24E-2773166IPR009057Homeodomain-like
PfamPF002491.4E-1573118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2574126IPR009057Homeodomain-like
CDDcd001675.27E-1376117No hitNo description
PROSITE profilePS5129426.222120174IPR017930Myb domain
SMARTSM007172.0E-13124172IPR001005SANT/Myb domain
PfamPF002491.3E-13125167IPR001005SANT/Myb domain
CDDcd001676.94E-11127167No hitNo description
Gene3DG3DSA:1.10.10.605.0E-20127173IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MKPWPATEAH TCSSPMVAMV NADIASLTLS SPSPASLFPS DCTTTTTSNE EDNNIKETTL  60
VLTECGQSKL CARGHWRPAE DSKLKELVSL YGPQNWNLIA EKLEGRSGKS CRLRWFNQLD  120
PRINRRAFSE DEEERLMQAH RVYGNKWAMI ARLFPGRTDN AVKNHWHVIM ARKYREQSSA  180
YRRRKLSNSN GGGTGGSCSN NSGGGDSGSY NTCSSSPPSS RMDEMMMMIP TANLFHNQNL  240
GDQQHHFING GRGIIKGGGG FVVPHQQTTF DFFPGGKSSS NEMMIMGMLS QSRSCWDHHQ  300
YQSNGNNNNN NNLAMQQSNY SLNQRIHHPT HHQMVISSSS SSFGDHQERS SSSAVVSSSS  360
NNPPPFIDFL GVGAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-33731737107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895032.11e-104PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0B0NX307e-97A0A0B0NX30_G
STRINGVIT_01s0026g02600.t015e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.16e-77myb domain protein 105